p53 AIP1 (TP53AIP1) (NM_001195195) Human Tagged ORF Clone

CAT#: RC230930

  • TrueORF®

TP53AIP1 (Myc-DDK-tagged)-Human tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 2


  "NM_001195195" in other vectors (3)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "TP53AIP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TP53AIP1
Synonyms P53AIP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC230930 representing NM_001195195
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGATCTTCCTCTGAGGCGAGCTTCAGATCTGCTCAAGCTTCCTGCAGTGGGGCCAGGAGGCAGGGCC
TGGGCAGGGGAGACCAGAACCTCTCGGTGATGCCTCCGAATGGCAGGGCTCAGACACACACACCTGGCTG
GGTTTCAGATCCCTTAGTTTTGGGTGCCCAAGTTCACGGAGGGTGCCGGGGAATAGAAGCTCTGTCAGTC
TCGTCTGGATCTTGGTCCTCAGCAACTGTCTGGATCCTGACAGTGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230930 representing NM_001195195
Red=Cloning site Green=Tags(s)

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSV
SSGSWSSATVWILTVQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001195195
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001195195.1, NP_001182124.1
RefSeq ORF 261
Locus ID 63970
Protein Families Druggable Genome
Protein Pathways p53 signaling pathway
MW 9.3 kDa
Gene Summary This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.