CLEC2D (NM_001197319) Human Tagged ORF Clone

CAT#: RC230936

  • TrueORF®

CLEC2D (Myc-DDK-tagged)-Human C-type lectin domain family 2, member D (CLEC2D), transcript variant 5


  "NM_001197319" in other vectors (3)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "CLEC2D"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CLEC2D
Synonyms CLAX; LLT1; OCIL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC230936 representing NM_001197319
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATGACAGTAACAATGTGGAGAAAGACATTACACCATCTGAATTGCCTGCAAACCCAGCAATAAGAG
CTAACTGCCATCAAGAGCCATCAGTATGTCTTCAAGCTGCATGCCCAGAAAGCTGGATTGGTTTTCAAAG
AAAGTGTTTCTATTTTTCTGATGACACCAAGAACTGGACATCAAGTCAGAGGTTTTGTGACTCACAAGAT
GCTGATCTTGCTCAGGTTGAAAGCTTCCAGGAACTGGTTTCCTATCCTGGGAGCAGGAGAGTGTGCCTAT
TTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230936 representing NM_001197319
Red=Cloning site Green=Tags(s)

MHDSNNVEKDITPSELPANPAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQD
ADLAQVESFQELVSYPGSRRVCLFE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001197319
ORF Size 285 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001197319.1, NM_001197319.2, NP_001184248.1
RefSeq Size 5069
RefSeq ORF 288
Locus ID 29121
Protein Families Druggable Genome, Transmembrane
MW 10.8 kDa
Gene Summary This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.