Oligodendrocyte Specific Protein (CLDN11) (NM_001185056) Human Tagged ORF Clone
CAT#: RC230958
- TrueORF®
CLDN11 (Myc-DDK-tagged)-Human claudin 11 (CLDN11), transcript variant 2
"NM_001185056" in other vectors (3)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CLDN11 |
Synonyms | OSP; OTM |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC230958 representing NM_001185056
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATTGCTGCCTCGGTCCTGGGTCTGCCGGCCATTTTACTGCTGCTGACTGTTCTTCCCTGCATCCGGA TGGGCCAGGAGCCCGGTGTGGCTAAGTACAGGCGGGCCCAGCTGGCTGGTGTTTTGCTCATTCTGCTGGC TCTCTGCGCCCTTGTTGCCACCATCTGGTTCCCTGTGTGCGCCCACCGTGAGACCACCATCGTGAGCTTT GGCTACTCCCTGTATGCAGGCTGGATTGGTGCTGTGCTGTGCCTCGTGGGTGGCTGTGTCATCCTCTGCT GCGCTGGAGATGCCCAGGCCTTTGGTGAAAACCGTTTCTACTACACTGCGGGCTCTAGCTCCCCGACTCA TGCGAAGAGTGCCCACGTA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC230958 representing NM_001185056
Red=Cloning site Green=Tags(s) MIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSF GYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001185056 |
ORF Size | 369 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001185056.1, NP_001171985.1 |
RefSeq ORF | 372 bp |
Locus ID | 5010 |
Cytogenetics | 3q26.2 |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
MW | 13.4 kDa |
Gene Summary | 'This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The protein encoded by this gene is a major component of central nervous system (CNS) myelin and plays an important role in regulating proliferation and migration of oligodendrocytes. Mouse studies showed that the gene deficiency results in deafness and loss of the Sertoli cell epithelial phenotype in the testis. This protein is a tight junction protein at the human blood-testis barrier (BTB), and the BTB disruption is related to a dysfunction of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Aug 2010]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RG230958 | CLDN11 (GFP-tagged) - Human claudin 11 (CLDN11), transcript variant 2 |
USD 460.00 |
|
RC230958L3 | Lenti-ORF clone of CLDN11 (Myc-DDK-tagged)-Human claudin 11 (CLDN11), transcript variant 2 |
USD 620.00 |
|
RC230958L4 | Lenti-ORF clone of CLDN11 (mGFP-tagged)-Human claudin 11 (CLDN11), transcript variant 2 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review