CD1E (NM_001185110) Human Tagged ORF Clone
CAT#: RC230969
- TrueORF®
CD1E (Myc-DDK-tagged)-Human CD1e molecule (CD1E), transcript variant 12
"NM_001185110" in other vectors (3)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CD1E |
Synonyms | CD1A; R2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC230969 representing NM_001185110
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGCTCCTGTTCCTCCTCTTCGAGGGTCTCTGCTGTCCTGGGGAAAATACAGCAGTGAAGCCAGAGG CCTGGCTGTCCTGTGGCCCCAGTCCTGGCCCTGGCCGTCTGCAGCTTGTGTGCCATGTCTCAGGATTCTA CCCAAAGCCCGTGTGGGTGATGTGGATGCGGGGTGGATATTCCATCTTTCTCATCCTGATCTGTTTGACT GTGATAGTTACCCTGGTCATATTGGTTGTAGTTGACTCACGGTTAAAAAAACAGAGCCCTGTCTTTCTCA TGGGAGCCAACACTCAGGACACCAAGAATTCAAGACATCAGTTCTGCTTGGCACAAGTATCGTGGATCAA AAACAGAGTATTGAAGAAGTGGAAGACACGCCTAAACCAACTCTGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC230969 representing NM_001185110
Red=Cloning site Green=Tags(s) MLLLFLLFEGLCCPGENTAVKPEAWLSCGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGGYSIFLILICLT VIVTLVILVVVDSRLKKQSPVFLMGANTQDTKNSRHQFCLAQVSWIKNRVLKKWKTRLNQLW myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001185110 |
ORF Size | 396 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001185110.1, NP_001172039.1 |
RefSeq ORF | 399 bp |
Locus ID | 913 |
Cytogenetics | 1q23.1 |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
MW | 15.5 kDa |
Gene Summary | 'This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes within Golgi compartments, endosomes, and lysosomes, and is cleaved into a stable soluble form. The soluble form is required for the intracellular processing of some glycolipids into a form that can be presented by other CD1 family members. Many alternatively spliced transcript variants encoding different isoforms have been described. Additional transcript variants have been found; however, their biological validity has not been determined. [provided by RefSeq, Jun 2010]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RG230969 | CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 12 |
USD 460.00 |
|
RC230969L3 | Lenti-ORF clone of CD1E (Myc-DDK-tagged)-Human CD1e molecule (CD1E), transcript variant 12 |
USD 620.00 |
|
RC230969L4 | Lenti-ORF clone of CD1E (mGFP-tagged)-Human CD1e molecule (CD1E), transcript variant 12 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review