ZNF195 (NM_001256823) Human Tagged ORF Clone

CAT#: RC231603

ZNF195 (Myc-DDK tagged) - Homo sapiens zinc finger protein 195 (ZNF195), transcript variant 8

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ZNF195
• Synonyms: HRF1; ZNFP104
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC231603 representing NM_001256823
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGGTGCTCAGACTCTGTTGACGTTCAGGGATGTGGCCATAGAATTCTCCCTGGAGGAGTGGAAAT
  GCCTGGACCTCGCTCAGCAGAATTTGTACAGGGATGTGATGTTGGAGAACTACAGAAACTTGTTCTCCGT
  TGGTCTCACTGTCTGTAAGCCAGGCCTGATCACCTGCCTGGAGCAACGAAAAGAGCCCTGGAATGTGAAG
  AGACAGGAGGCAGCAGACGGACATCCAGGTATTTTCTTTGTGGTTACCATGGAAATTATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC231603 representing NM_001256823
  Red=Cloning site Green=Tags(s)
  
  MAGAQTLLTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLITCLEQRKEPWNVK
  RQEAADGHPGIFFVVTMEII
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001256823
• ORF Size: 270 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001256823.1, NP_001243752.1
• RefSeq Size: 3203 bp
• RefSeq ORF: 273 bp
• Locus ID: 7748
• Cytogenetics: 11p15.4
• Protein Families: Transcription Factors
• MW: 10.8 kDa
• Gene Summary: 'This gene encodes a protein belonging to the Krueppel C2H2-type zinc-finger protein family. These family members are transcription factors that are implicated in a variety of cellular processes. This gene is located near the centromeric border of chromosome 11p15.5, next to an imprinted domain that is associated with maternal-specific loss of heterozygosity in Wilms' tumors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]'