GTF2H3 (NM_001271868) Human Tagged ORF Clone

CAT#: RC231912

GTF2H3 (Myc-DDK tagged) - Homo sapiens general transcription factor IIH, polypeptide 3, 34kDa (GTF2H3), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GTF2H3
• Synonyms: BTF2; P34; TFB4; TFIIH
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC231912 representing NM_001271868
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAACAAGGAAGTTAAAGACAATCAGGAAATGAAATCAAGGATATTGGTGATTAAGGCTGCAGAAGACA
  GTGCGTTGCAGTATATGAACTTCATGAATGTCATCTTTGCAGCACAGAAACAGAATATTTTGATTGATGC
  CTGTGTTTTAGACTCCGACTCAGGGCTCCTCCAACAGGCTTGTGACATCACGGGAGGACTGTACCTGAAG
  GTGCCTCAGATGCCTTCTCTTCTGCAGTATTTGCTGTGGGTGTTTCTTCCCGATCAAGATCAGAGATCTC
  AGTTAATCCTCCCACCCCCAGTTCATGTTGACTACAGGGCTGCTTGCTTCTGTCATCGAAATCTCATTGA
  AATTGGTTATGTCTGTTCTGTGTGTTTGTCAATATTCTGCAATTTCAGCCCCATTTGTACTACGTGCGAG
  ACAGCCTTTAAAATTTCTCTGCCTCCAGTGCTGAAAGCCAAGAAAAAGAAACTGAAAGTGTCTGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC231912 representing NM_001271868
  Red=Cloning site Green=Tags(s)
  
  MNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLK
  VPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCE
  TAFKISLPPVLKAKKKKLKVSA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001271868
• ORF Size: 486 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001271868.1, NP_001258797.1
• RefSeq Size: 3270 bp
• RefSeq ORF: 489 bp
• Locus ID: 2967
• Cytogenetics: 12q24.31
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Basal transcription factors, Nucleotide excision repair
• MW: 18.7 kDa
• Gene Summary: 'This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. [provided by RefSeq, Dec 2012]'