Glycophorin C (GYPC) (NM_001256584) Human Tagged ORF Clone

CAT#: RC233261

  • TrueORF®

GYPC (Myc-DDK tagged) - Homo sapiens glycophorin C (Gerbich blood group) (GYPC), transcript variant 3


  "NM_001256584" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "GYPC"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GYPC
Synonyms CD236; CD236R; GE; GE:GPC:GPD:GYPD; GPC; GPD; GYPD; PAS-2; PAS-2'
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC233261 representing NM_001256584
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCTGCCTCCACCACAATGCATACTACCACCATTGCAGAGCCTGATCCAGGGATGTCTGGATGGC
CGGATGGCAGAATGGAGACCTCCACCCCCACCATAATGGACATTGTCGTCATTGCAGGTGTGATTGCTGC
TGTGGCCATCGTCCTAGTCTCCCTCCTCTTCGTCATGCTGCGCTACATGTACCGGCACAAGGGCACGTAC
CACACCAATGAGGCCAAGGGCACGGAGTTTGCTGAGAGTGCAGATGCAGCCCTGCAGGGAGACCCTGCCC
TCCAAGATGCTGGTGATAGCAGCAGAAAGGAGTACTTTATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC233261 representing NM_001256584
Red=Cloning site Green=Tags(s)

MASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTY
HTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001256584
ORF Size 321 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001256584.1, NP_001243513.1
RefSeq Size 2067 bp
RefSeq ORF 324 bp
Locus ID 2995
Cytogenetics 2q14.3
Protein Families Druggable Genome, Transmembrane
MW 11.9 kDa
Gene Summary 'Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.