MAGP2 (MFAP5) (NM_001297712) Human Tagged ORF Clone

CAT#: RC235677

  • TrueORF®

MFAP5 (myc-DDK-tagged) - Human microfibrillar associated protein 5 (MFAP5), transcript variant 5


  "NM_001297712" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "MFAP5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MFAP5
Synonyms AAT9; MAGP-2; MAGP2; MFAP-5; MP25
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC235677 representing NM_001297712
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTCTTGGGACCCAAGGTGCTGCTGTTTCTTGCTGCATTCATCATCACCTCTGACTGGATACCCC
TGGGGGTCAATAGTCAACGAGGAGACGATGTGACTCAAGCGACTCCAGAAACATTCACAGAAGATCCTAA
TCTGGTGAATGATCCCGCTACAGATGAAACAGTTTTGGCTGTTTTGGCTGATATTGCACCTTCCACAGAT
GACTTGGATGAGCTTTGCCGTCAGATGGCTGGTCTGCCCCCTAGGAGACTCCGTCGCTCCAATTACTTCC
GACTTCCTCCCTGTGAAAATGTGGATTTGCAGAGACCCAATGGTCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC235677 representing NM_001297712
Red=Cloning site Green=Tags(s)

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD
DLDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001297712
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001297712.1, NP_001284641.1
RefSeq Size 2757
RefSeq ORF 330
Locus ID 8076
Protein Families Secreted Protein
MW 12.5 kDa
Gene Summary This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.