CDIPT (NM_001286586) Human Tagged ORF Clone

CAT#: RC236059

  • TrueORF®

CDIPT (myc-DDK-tagged) - Human CDP-diacylglycerol--inositol 3-phosphatidyltransferase (CDIPT), transcript variant 3


  "NM_001286586" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "CDIPT"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDIPT
Synonyms PIS; PIS1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236059 representing NM_001286586
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGACATGCTGACGGACCGCTGCTCCACCATGTGCCTGTTGGTCAACCTGGCCCTGCTGTACCCTG
GAGCCACGCTGTTCTTCCAAATCAGCATGAGTTTGGATGTGGCCAGTCACTGGCTGCACCTCCACAGTTC
TGTGGTCCGAGGCAGTGAGAGTCACAAGATGATCGACTTGTCCGGGAATCCGGTGCTTCGGATCTACTAC
ACCTCGAGGCCTGCTCTGTTCACCTTGTGTGCTGGGAATGAGCTCTTCTACTGCCTCCTCTACCTGTTCC
ATTTCTCTGAGGGACCTTTAGTTGGCTCTGTGGGACTGTTCCGGATGGGCCTCTGGGTCACTGCCCCCAT
CGCCTTGCTGAAGTCGCTCATCAGCGTCATCCACCTGATCACGGCCGCCCGCAACATGGCTGCCCTGGAC
GCAGCAGACCGCGCCAAGAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236059 representing NM_001286586
Red=Cloning site Green=Tags(s)

MLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYY
TSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALD
AADRAKKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001286586
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001286586.1, NP_001273515.1
RefSeq Size 1843
RefSeq ORF 447
Locus ID 10423
Protein Families Transmembrane
Protein Pathways Glycerophospholipid metabolism, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 16.8 kDa
Gene Summary Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.