AP2S1 (NM_001301076) Human Tagged ORF Clone

CAT#: RC236151

  • TrueORF®

AP2S1 (myc-DDK-tagged) - Human adaptor-related protein complex 2, sigma 1 subunit (AP2S1), transcript variant 3


  "NM_001301076" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "AP2S1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AP2S1
Synonyms AP17; CLAPS2; FBH3; FBHOk; HHC3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236151 representing NM_001301076
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTTAAGGGTCTGGGAAAGCGCTGTAAAAGGAGAGAGGACCTGGAGATCCGCTTTATCCTCATCC
AGAACCGGGCAGGCAAGACGCGCCTGGCCAAGTGGTACATGCAGTTTGATGATGATGAGAAACAGAAGCT
GATCGAGGAGGTGCATGCCGTGGTCACCGTCCGAGACGCCAAACACACCAACTTTGTGGAGTTCCGGAAC
TTTAAGATCATTTACCGCCGCTATGCTGGCCTCTACTTCTGCATCTGTGTGGATGTCAATGACAACAACC
TGGCTTACCTGGAGGCCATTCACAACTTCGTGGAGGTCTTAAACGAATATTTCCACAATGTCTGTGAACT
GGACCTGGTGTTCAACTTCTACAAGGTTTACACGGTCGTGGACGAGATGTTCCTGGCTGGCGAAATCCGA
GAGACCAGCCAGACGAAGGTGCTGAAACAGCTGCTGATGCTACAGTCCCTGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236151 representing NM_001301076
Red=Cloning site Green=Tags(s)

MKLKGLGKRCKRREDLEIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRN
FKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIR
ETSQTKVLKQLLMLQSLE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301076
ORF Size 474 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001301076.1, NP_001288005.1
RefSeq Size 890 bp
RefSeq ORF 477 bp
Locus ID 1175
Cytogenetics 19q13.32
Protein Pathways Endocytosis, Huntington's disease
MW 19.4 kDa
Gene Summary 'One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.