NBL1 (NM_001278166) Human Tagged ORF Clone

CAT#: RC236327

NBL1 (myc-DDK-tagged) - Human neuroblastoma 1, DAN family BMP antagonist (NBL1), transcript variant 8

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NBL1
• Synonyms: D1S1733E; DAN; DAND1; NB; NO3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236327 representing NM_001278166
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATGCTTCGGGTCCTGGTGGGGGCTGTCCTCCCTGCCATGCTACTGGCTGCCCCACCACCCATCAACA
  AGCTGGCACTGTTCCCAGATAAGAGTGCCTGGTGCGAAGCCAAGAACATCACCCAGATCGTGGGCCACAG
  CGGCTGTGAGGCCAAGTCCATCCAGAACAGGGCGTGCCTAGGACAGTGCTTCAGCTACAGCGTCCCCAAC
  ACCTTCCCACAGTCCACAGAGTCCCTGGTTCACTGTGACTCCTGCATGCCAGCCCAGTCCATGTGGGAGA
  TTGTGACGCTGGAGTGCCCGGGCCACGAGGAGGTGCCCAGGGTGGACAAGCTGGTGGAGAAGATCCTGCA
  CTGTAGCTGCCAGGCCTGCGGCAAGGAGCCTAGTCACGAGGGGCTGAGCGTCTATGTGCAGGGCGAGGAC
  GGGCCGGGATCCCAGCCCGGCACCCACCCTCACCCCCATCCCCACCCCCATCCTGGCGGGCAGACCCCTG
  AGCCCGAGGACCCCCCTGGGGCCCCCCACACAGAGGAAGAGGGGGCTGAGGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236327 representing NM_001278166
  Red=Cloning site Green=Tags(s)
  
  MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPN
  TFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGED
  GPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001278166
• ORF Size: 543 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001278166.1, NP_001265095.1
• RefSeq Size: 1971 bp
• RefSeq ORF: 546 bp
• Locus ID: 4681
• Cytogenetics: 1p36.13
• Protein Families: Secreted Protein
• MW: 19.9 kDa
• Gene Summary: 'This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. [provided by RefSeq, May 2013]'