RWDD3 (NM_001278247) Human Tagged ORF Clone

CAT#: RC236380

RWDD3 (myc-DDK-tagged) - Human RWD domain containing 3 (RWDD3), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RWDD3
• Synonyms: RSUME
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236380 representing NM_001278247
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTTCTTTCCTGTGGTTCCCTGCACCAGAGAGGACCCGAGACAGATGGGACCGTGTTCAGAATTCACA
  CAAAAGCTGAAGGATTTATGGATGCGGATATACCTCTGGAATTGGTGTTCCATTTGCCAGTCAATTATCC
  TTCATGTCTACCTGGTATCTCGATTAACTCTGAACAGTTGACCAGGGCCCAGTGTGTGACTGTGAAAGAG
  AATTTACTTGAGCAAGCAGAGAGCCTTTTGTCGGAGCCTATGGTTCATGAGCTGGTTCTCTGGATTCAGC
  AGAATCTCAGGCATATCCTCAGCCAACCAGAAACTGGCAGTGGCAGTGAAAAGTGTACTTTTTCAACAAG
  CACGACCATGGATGATGGATTGTGGATAACTCTTTTGCATTTAGATCACATGAGAGCAAAGACTAAATAT
  GTCAAAATTGTGGAGAAGTGGGCTTCAGATTTAAGGCTGACAGGAAGACTGATGTTCATGGGAGTACTTG
  ATTCTTCAGAAAACCTCCAAAGTAGATGTGGACTCAAGTGGAAAGAAATGCAAAGAGAAAATGAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236380 representing NM_001278247
  Red=Cloning site Green=Tags(s)
  
  MFLSCGSLHQRGPETDGTVFRIHTKAEGFMDADIPLELVFHLPVNYPSCLPGISINSEQLTRAQCVTVKE
  NLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWITLLHLDHMRAKTKY
  VKIVEKWASDLRLTGRLMFMGVLDSSENLQSRCGLKWKEMQREND
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001278247
• ORF Size: 555 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001278247.1, NP_001265176.1
• RefSeq Size: 1336
• RefSeq ORF: 558
• Locus ID: 25950
• MW: 21.5 kDa
• Gene Summary: Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target proteins which include HIF1A, PIAS, NFKBIA, NR3C1 and TOP1. Isoform 1 and isoform 2 positively regulate the NF-kappa-B signaling pathway by enhancing the sumoylation of NF-kappa-B inhibitor alpha (NFKBIA), promoting its stabilization which consequently leads to an increased inhibition of NF-kappa-B transcriptional activity. Isoform 1 and isoform 2 negatively regulate the hypoxia-inducible factor-1 alpha (HIF1A) signaling pathway by increasing the sumoylation of HIF1A, promoting its stabilization, transcriptional activity and the expression of its target gene VEGFA during hypoxia. Isoform 2 promotes the sumoylation and transcriptional activity of the glucocorticoid receptor NR3C1 and enhances the interaction of SUMO1 and NR3C1 with UBE2I/UBC9. Has no effect on ubiquitination. [UniProtKB/Swiss-Prot Function]