beta Casein (CSN2) (NM_001302770) Human Tagged ORF Clone

CAT#: RC236713

CSN2 (myc-DDK-tagged) - Human casein beta (CSN2), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CSN2
• Synonyms: CASB
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236713 representing NM_001302770
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGGTCCTCATCCTCGCCTGCCTGGTGGCTCTTGCTCTTGCAAGGGAGACCATAGAAAGCCTTTCAA
  GCAGTGAGGAATCTATTACAGAATACAAGAAAGTTGAGAAGGTTAAACATGAGGACCAGCAGCAAGGAGA
  GGATGAACACCAGGATAAAATCTACCCCTCTTTCCAGCCACAGCCTCTGATCTATCCATTCGTTGAACCT
  ATCCCCTATGGTTTTCTTCCACAAAACATTCTGCCTCTTGCTCAGCCTGCTGTGGTGCTGCCTGTCCCTC
  AGCCTGAAATAATGGAAGTCCCTAAAGCTAAAGACACTGTCTACACTAAGGGCAGAGTGATGCCTGTCCT
  TAAATCTCCAACGATACCCTTTTTTGACCCTCAAATCCCAAAACTCACTGATCTTGAAAATCTGCATCTT
  CCTCTGCCTCTGCTCCAGCCCTTGATGCAGCAGGTCCCTCAGCCTATTCCTCAGACTCTTGCACTTCCCC
  CTCAGCCCCTGTGGTCTGTTCCTCAGCCCAAAGTCCTGCCTATCCCCCAGCAAGTGGTGCCCTACCCTCA
  GAGAGCTGTGCCTGTTCAAGCCCTTCTGCTCAACCAAGAACTTCTACTTAACCCCACCCACCAGATCTAC
  CCTGTGACTCAGCCACTTGCCCCAGTTCATAACCCCATTAGTGTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236713 representing NM_001302770
  Red=Cloning site Green=Tags(s)
  
  MKVLILACLVALALARETIESLSSSEESITEYKKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEP
  IPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHL
  PLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIY
  PVTQPLAPVHNPISV
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001302770
• ORF Size: 675 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001302770.1, NP_001289699.1
• RefSeq Size: 1078 bp
• RefSeq ORF: 678 bp
• Locus ID: 1447
• Cytogenetics: 4q13.3
• Protein Families: Secreted Protein
• MW: 25.7 kDa
• Gene Summary: 'This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020]'