Proteasome subunit alpha type 6 (PSMA6) (NM_001282234) Human Tagged ORF Clone

CAT#: RC236724

PSMA6 (myc-DDK-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 6 (PSMA6), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PSMA6
• Synonyms: IOTA; p27K; PROS27
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236724 representing NM_001282234
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGGTCTTCGGAGAGAATATGCTTTTAAGGCTATTAACCAGGGTGGCCTTACATCAGTAGCTGTCA
  GAGGGAAAGACTGTGCAGTAATTGTCACACAGAAGAAAGTACCTGACAAATTATTGGATTCCAGCACAGT
  GACTCACTTATTCAAGATAACTGAAAACATTGGTTGTGTGATGACCGGAATGACAGCTGACAGCAGATCC
  CAGGTACAGAGGGCACGCTATGAGGCAGCTAACTGGAAATACAAGTATGGCTATGAGATTCCTGTGGACA
  TGCTGTGTAAAAGAATTGCCGATATTTCTCAGGTCTACACACAGAATGCTGAAATGAGGCCTCTTGGTTG
  TTGTATGATTTTAATTGGTATAGATGAAGAGCAAGGCCCTCAGGTATATAAGTGTGATCCTGCAGGTTAC
  TACTGTGGGTTTAAAGCCACTGCAGCGGGAGTTAAACAAACTGAGTCAACCAGCTTCCTTGAAAAAAAAG
  TGAAGAAGAAATTTGATTGGACATTTGAACAGACAGTGGAAACTGCAATTACATGCCTGTCTACTGTTCT
  ATCAATTGATTTCAAACCTTCAGAAATAGAAGTTGGAGTAGTGACAGTTGAAAATCCTAAATTCAGGATT
  CTTACAGAAGCAGAGATTGATGCTCACCTTGTTGCTCTAGCAGAGAGAGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236724 representing NM_001282234
  Red=Cloning site Green=Tags(s)
  
  MAGLRREYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRS
  QVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGY
  YCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRI
  LTEAEIDAHLVALAERD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001282234
• ORF Size: 681 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001282234.1, NP_001269163.1
• RefSeq Size: 1016 bp
• RefSeq ORF: 684 bp
• Locus ID: 5687
• Cytogenetics: 14q13.2
• Protein Families: Druggable Genome, Protease, Stem cell - Pluripotency
• Protein Pathways: Proteasome
• MW: 25.7 kDa
• Gene Summary: 'The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome. [provided by RefSeq, Aug 2013]'