IL10RB (NM_000628) Human Tagged ORF Clone
CAT#: RG200679
- TrueORF®
IL10RB (GFP-tagged) - Human interleukin 10 receptor, beta (IL10RB)
"NM_000628" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | IL10RB |
Synonyms | CDW210B; CRF2-4; CRFB4; D21S58; D21S66; IL-10R2 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG200679 representing NM_000628
Red=Cloning site Green=Tags(s) MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTT LTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEY ETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCE QTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLF FSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000628 |
ORF Size | 975 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000628.3, NP_000619.3 |
RefSeq Size | 1966 bp |
RefSeq ORF | 978 bp |
Locus ID | 3588 |
Cytogenetics | 21q22.11 |
Domains | Tissue_fac |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Gene Summary | 'The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC321349 | IL10RB (untagged)-Human interleukin 10 receptor, beta (IL10RB) |
USD 540.00 |
|
RC200679 | IL10RB (Myc-DDK-tagged)-Human interleukin 10 receptor, beta (IL10RB) |
USD 98.00 |
|
RC200679L1 | Lenti ORF clone of Human interleukin 10 receptor, beta (IL10RB), Myc-DDK-tagged |
USD 620.00 |
|
RC200679L2 | Lenti ORF clone of Human interleukin 10 receptor, beta (IL10RB), mGFP tagged |
USD 620.00 |
|
RC200679L3 | Lenti ORF clone of Human interleukin 10 receptor, beta (IL10RB), Myc-DDK-tagged |
USD 620.00 |
|
RC200679L4 | Lenti ORF clone of Human interleukin 10 receptor, beta (IL10RB), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review