MRPS12 (NM_033362) Human Tagged ORF Clone

CAT#: RG202911

  • TrueORF®

MRPS12 (GFP-tagged) - Human mitochondrial ribosomal protein S12 (MRPS12), nuclear gene encoding mitochondrial protein, transcript variant 2


  "NM_033362" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "MRPS12"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MRPS12
Synonyms MPR-S12; MT-RPS12; RPMS12; RPS12; RPSM12
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG202911 representing NM_033362
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCTGGTCTGGCCTTCTCCATGGCCTCAACACGTCCCTAACTTGTGGCCCAGCTCTGGTTCCCCGGC
TCTGGGCTACCTGCTCCATGGCTACCCTGAACCAGATGCACCGCCTGGGGCCCCCCAAGCGGCCGCCTCG
GAAGCTGGGCCCCACGGAAGGCCGGCCGCAGCTGAAGGGTGTGGTCCTGTGCACGTTTACCCGCAAGCCG
AAGAAGCCCAACTCAGCCAATCGCAAGTGCTGTCGAGTGCGGCTCAGCACTGGCCGCGAGGCCGTCTGCT
TCATCCCTGGGGAGGGCCACACCCTGCAGGAGCACCAGATTGTCCTTGTGGAGGGCGGCCGCACCCAGGA
CCTGCCAGGCGTCAAGCTCACCGTTGTGCGTGGCAAGTACGACTGTGGCCACGTGCAGAAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG202911 representing NM_033362
Red=Cloning site Green=Tags(s)

MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKP
KKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033362
ORF Size 414 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033362.2, NP_203526.1
RefSeq Size 1116 bp
RefSeq ORF 417 bp
Locus ID 6183
Cytogenetics 19q13.2
Domains Ribosomal_S12
Protein Families Druggable Genome, Stem cell - Pluripotency
Gene Summary 'Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4). Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.