MRPS21 (NM_031901) Human Tagged ORF Clone

CAT#: RG203193

  • TrueORF®

MRPS21 (GFP-tagged) - Human mitochondrial ribosomal protein S21 (MRPS21), nuclear gene encoding mitochondrial protein, transcript variant 1


  "NM_031901" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "MRPS21"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol MRPS21
Synonyms MDS016; MRP-S21; RPMS21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203193 representing NM_031901
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAAACATCTGAAGTTCATCGCCAGGACTGTGATGGTACAGGAAGGGAACGTGGAAAGCGCATACA
GGACCCTAAACAGAATCCTCACTATGGATGGGCTCATTGAGGACATTAAGCATCGGCGGTATTATGAGAA
GCCATGCCGCCGGCGACAGAGGGAAAGCTATGAAAGGTGCCGGCGGATCTACAACATGGAAATGGCTCGC
AAGATCAACTTCTTGATGCGAAAGAATCGGGCAGATCCGTGGCAGGGCTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203193 representing NM_031901
Red=Cloning site Green=Tags(s)

MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMAR
KINFLMRKNRADPWQGC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031901
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_031901.3, NP_114107.1
RefSeq Size 483
RefSeq ORF 264
Locus ID 54460
Gene Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.