MCP4 (CCL13) (NM_005408) Human Tagged ORF Clone

CAT#: RG203789

  • TrueORF®

CCL13 (GFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13)


  "NM_005408" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "CCL13"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CCL13
Synonyms CKb10; MCP-4; NCC-1; NCC1; SCYA13; SCYL1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203789 representing NM_005408
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTCTCTGCAGTGCTTCTGTGCCTGCTGCTCATGACAGCAGCTTTCAACCCCCAGGGACTTGCTC
AGCCAGATGCACTCAACGTCCCATCTACTTGCTGCTTCACATTTAGCAGTAAGAAGATCTCCTTGCAGAG
GCTGAAGAGCTATGTGATCACCACCAGCAGGTGTCCCCAGAAGGCTGTCATCTTCAGAACCAAACTGGGC
AAGGAGATCTGTGCTGACCCAAAGGAGAAGTGGGTCCAGAATTATATGAAACACCTGGGCCGGAAAGCTC
ACACCCTGAAGACT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203789 representing NM_005408
Red=Cloning site Green=Tags(s)

MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLG
KEICADPKEKWVQNYMKHLGRKAHTLKT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005408
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005408.2, NP_005399.1
RefSeq Size 861 bp
RefSeq ORF 297 bp
Locus ID 6357
Cytogenetics 17q12
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, NOD-like receptor signaling pathway
Gene Summary 'This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.