NT5C (NM_014595) Human Tagged ORF Clone
CAT#: RG204265
- TrueORF®
NT5C (GFP-tagged) - Human 5', 3'-nucleotidase, cytosolic (NT5C)
"NM_014595" in other vectors (7)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | NT5C |
Synonyms | cdN; DNT; dNT-1; DNT1; HEL74; P5N2; PN-I; PN-II; UMPH2 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG204265 representing NM_014595
Red=Cloning site Green=Tags(s) MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGF FLDLEPIPGALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVLGD LLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWSDNWREILDSKRGAAQRE TRTRRLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014595 |
ORF Size | 603 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Reference Data | |
RefSeq | NM_014595.1, NP_055410.1 |
RefSeq Size | 970 |
RefSeq ORF | 606 |
Locus ID | 30833 |
Protein Families | Transcription Factors |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Gene Summary | This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC114947 | NT5C (untagged)-Human 5', 3'-nucleotidase, cytosolic (NT5C) |
USD 420.00 |
|
SC320933 | NT5C (untagged)-Human 5', 3'-nucleotidase, cytosolic (NT5C) |
USD 420.00 |
|
RC204265 | NT5C (Myc-DDK-tagged)-Human 5', 3'-nucleotidase, cytosolic (NT5C) |
USD 98.00 |
|
RC204265L1 | Lenti ORF clone of Human 5', 3'-nucleotidase, cytosolic (NT5C), Myc-DDK-tagged |
USD 768.00 |
|
RC204265L2 | Lenti ORF clone of Human 5', 3'-nucleotidase, cytosolic (NT5C), mGFP tagged |
USD 620.00 |
|
RC204265L3 | Lenti ORF clone of Human 5', 3'-nucleotidase, cytosolic (NT5C), Myc-DDK-tagged |
USD 620.00 |
|
RC204265L4 | Lenti ORF clone of Human 5', 3'-nucleotidase, cytosolic (NT5C), mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review