Profilin 2 (PFN2) (NM_053024) Human Tagged ORF Clone

CAT#: RG207366

  • TrueORF®

PFN2 (GFP-tagged) - Human profilin 2 (PFN2), transcript variant 1


  "NM_053024" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "PFN2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PFN2
Synonyms D3S1319E; PFL
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG207366 representing NM_053024
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGTTGGCAGAGCTACGTGGATAACCTGATGTGCGATGGCTGCTGCCAGGAGGCCGCCATTGTCG
GCTACTGCGACGCCAAATACGTCTGGGCAGCCACGGCCGGGGGCGTCTTTCAGAGCATTACGCCAATAGA
AATAGATATGATTGTAGGAAAAGACCGGGAAGGTTTCTTTACCAACGGTTTGACTCTTGGCGCGAAGAAA
TGCTCAGTGATCAGAGATAGTCTATACGTCGATGGTGACTGCACAATGGACATCCGGACAAAGAGTCAAG
GTGGGGAGCCAACATACAATGTGGCTGTCGGCAGAGCTGGTAGAGTCTTGGTCTTTGTAATGGGAAAAGA
AGGGGTCCATGGAGGCGGATTGAATAAGAAGGCATACTCAATGGCAAAATACTTGAGAGACTCTGGGTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207366 representing NM_053024
Red=Cloning site Green=Tags(s)

MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLTLGAKK
CSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_053024
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_053024.2, NP_444252.1
RefSeq Size 2272 bp
RefSeq ORF 423 bp
Locus ID 5217
Cytogenetics 3q25.1
Domains PROF
Protein Families Druggable Genome
Protein Pathways Regulation of actin cytoskeleton
Gene Summary 'The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.