RPL41 (NM_021104) Human Tagged ORF Clone

CAT#: RG209076

  • TrueORF®

RPL41 (GFP-tagged) - Human ribosomal protein L41 (RPL41), transcript variant 1


  "NM_021104" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "RPL41"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol RPL41
Synonyms L41
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG209076 representing NM_021104
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATTTTGTTTATGAGCAAGGTGGGTCTCAGAGGTGATCGGCGATCAGAGGGCGATGAAGTTCTAG
ATCCATTGAGACAAGCTCTAGACAGTAGCATGCAGTCCCACAACTTGTACCAGCATCCCCAGCATCTGGC
ATTCCATGTTTCTGCTCCTGTGGCCTCCACAGTGCAACAAGCTAGCGGTTTACTTGGACCTCTACCTCAT
CTTTCTTCTTTTGCGCTTCAGCCTGCGCATTCGCTTCTTCCTCCACTTGGCTCTCATGGTGCAGGTTTCC
AAGAAAATGGCGCTAAGGCCGAGAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG209076 representing NM_021104
Red=Cloning site Green=Tags(s)

MGILFMSKVGLRGDRRSEGDEVLDPLRQALDSSMQSHNLYQHPQHLAFHVSAPVASTVQQASGLLGPLPH
LSSFALQPAHSLLPPLGSHGAGFQENGAKAES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021104
ORF Size 75 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021104.1, NP_066927.1
RefSeq Size 478 bp
RefSeq ORF 78 bp
Locus ID 6171
Cytogenetics 12q13.2
Protein Pathways Ribosome
Gene Summary 'Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which shares sequence similarity with the yeast ribosomal protein YL41, belongs to the L41E family of ribosomal proteins. It is located in the cytoplasm. The protein can interact with the beta subunit of protein kinase CKII and can stimulate the phosphorylation of DNA topoisomerase II-alpha by CKII. Two alternative splice variants have been identified, both encoding the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.