NUDT2 (NM_147173) Human Tagged ORF Clone

CAT#: RG219598

  • TrueORF®

NUDT2 (GFP-tagged) - Human nudix (nucleoside diphosphate linked moiety X)-type motif 2 (NUDT2), transcript variant 3


  "NM_147173" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "NUDT2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol NUDT2
Synonyms APAH1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG219598 representing NM_147173
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTTGAGAGCATGTGGCTTGATCATCTTCCGAAGATGCCTCATTCCCAAAGTGGACAACAATGCAA
TTGAGTTTTTACTGCTGCAGGCATCAGATGGCATTCATCACTGGACTCCTCCCAAAGGCCATGTGGAACC
AGGAGAGGATGACTTGGAAACAGCCCTGAGGGAGACCCAAGAGGAAGCAGGCATAGAAGCAGGCCAGCTG
ACCATTATTGAGGGGTTCAAAAGGGAACTCAATTATGTGGCCAGGAACAAGCCTAAAACAGTCATTTACT
GGCTGGCGGAGGTGAAGGACTATGACGTGGAGATCCGCCTCTCCCATGAGCACCAAGCCTACCGCTGGCT
GGGGCTGGAGGAGGCCTGCCAGTTGGCTCAGTTCAAGGAGATGAAGGCAGCGCTCCAAGAAGGACACCAG
TTTCTTTGCTCCATAGAGGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG219598 representing NM_147173
Red=Cloning site Green=Tags(s)

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL
TIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQ
FLCSIEA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_147173
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_147173.1, NP_671702.1
RefSeq Size 947 bp
RefSeq ORF 444 bp
Locus ID 318
Cytogenetics 9p13.3
Domains NUDIX
Protein Pathways Purine metabolism, Pyrimidine metabolism
Gene Summary 'This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and four transcript variants, all encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.