PF4V1 (NM_002620) Human Tagged ORF Clone

CAT#: RG220116

PF4V1 (GFP-tagged) - Human platelet factor 4 variant 1 (PF4V1)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: PF4V1
• Synonyms: CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG220116 representing NM_002620
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCTCCGCAGCCAGGTCCCGCCTCACCCGCGCCACCCGCCAGGAGATGCTGTTCTTGGCGTTGCTGC
  TCCTGCCAGTTGTGGTCGCCTTCGCCAGAGCTGAAGCTGAAGAAGATGGGGACCTGCAGTGCCTGTGTGT
  GAAGACCACCTCCCAGGTCCGTCCCAGGCACATCACCAGCCTGGAGGTGATCAAGGCCGGACCCCACTGC
  CCCACTGCCCAACTCATAGCCACGCTGAAGAATGGGAGGAAAATTTGCTTGGATCTGCAAGCCCTGCTGT
  ACAAGAAAATCATTAAGGAACATTTGGAGAGT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG220116 representing NM_002620
  Red=Cloning site Green=Tags(s)
  
  MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC
  PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002620
• ORF Size: 312 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002620.1, NP_002611.1
• RefSeq Size: 755 bp
• RefSeq ORF: 315 bp
• Locus ID: 5197
• Cytogenetics: 4q13.3
• Protein Families: Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction
• Gene Summary: 'The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015]'