HIST1H2BB (NM_021062) Human Tagged ORF Clone

CAT#: RG220710

  • TrueORF®

HIST1H2BB (GFP-tagged) - Human histone cluster 1, H2bb (HIST1H2BB)


  "NM_021062" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "HIST1H2BB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol HIST1H2BB
Synonyms H2B.1; H2B/f; H2BFF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG220710 representing NM_021062
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGAACCCTCTAAGTCTGCTCCAGCCCCTAAAAAGGGTTCTAAGAAGGCTATCACTAAGGCGCAGA
AGAAGGATGGTAAGAAGCGTAAGCGCAGCCGCAAGGAGAGCTATTCTATCTATGTGTACAAGGTTCTGAA
GCAGGTCCACCCCGACACCGGCATCTCATCCAAGGCCATGGGGATCATGAATTCCTTCGTCAACGACATC
TTCGAGCGCATCGCGGGCGAGGCTTCTCGCCTGGCTCACTACAATAAGCGCTCGACCATCACCTCCAGGG
AGATTCAGACGGCTGTGCGCCTGCTGCTGCCTGGGGAGCTGGCTAAGCATGCTGTGTCCGAGGGCACTAA
GGCAGTTACCAAGTACACTAGCTCTAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220710 representing NM_021062
Red=Cloning site Green=Tags(s)

MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021062
ORF Size 378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021062.2, NP_066406.1
RefSeq Size 431 bp
RefSeq ORF 381 bp
Locus ID 3018
Cytogenetics 6p22.2
Protein Pathways Systemic lupus erythematosus
Gene Summary 'Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.