IMPA1 (NM_001144879) Human Tagged ORF Clone

CAT#: RG227552

  • TrueORF®

IMPA1 (GFP-tagged) - Human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 3


  "NM_001144879" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "IMPA1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol IMPA1
Synonyms IMP; IMPA; MRT59
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG227552 representing NM_001144879
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATCCTTGGCAGGAATGCATGGATTATGCAGTAACTCTAGCAAGACAAGCTGGAGAGGTAGTTT
GTGAAGCTATAAAAAATGAAATGAATGTTATGCTGAAAAGTTCTCCAGTTGATTTGGTAACTGCTACGGA
CCAAAAAGTTGAAAAAATGCTTATCTCTTCCATAAAGGAAAAGTATCCATCTCACAGTTTCATTGGTGAA
GAATCTGTGGCAGCTGGGGAAAAAAGTATCTTAACCGACAACCCCACATGGATCATTGACCCTATTGATG
GAACAACTAACTTTGTACATAGATTTCCTTTTGTAGCTGTTTCAATTGGCTTTGCTGTAAATAAAAAGAT
AGAATTTGGAGTTGTGTACAGTTGTGTGGAAGGCAAGATGTACACTGCCAGAAAAGGAAAAGGTGCCTTT
TGTAATGGTCAAAAACTACAAGTTTCACAACAAGAAGGATCCGGAGTGTTGGAACAGCAGCTGTTAATAT
GTGCCTTGTGGCAACTGGCGGAGCAGATGCATATTATGAAATGGGAATTCACTGCTGGGATGTTGCAGGA
GCTGGCATTATTGTTACTGAAGCTGGTGGCGTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG227552 representing NM_001144879
Red=Cloning site Green=Tags(s)

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE
ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF
CNGQKLQVSQQEGSGVLEQQLLICALWQLAEQMHIMKWEFTAGMLQELALLLLKLVAC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001144879
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001144879.1, NP_001138351.1
RefSeq Size 3287 bp
RefSeq ORF 597 bp
Locus ID 3612
Cytogenetics 8q21.13
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Gene Summary 'This gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13. [provided by RefSeq, Dec 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.