UBE2H (NM_001202498) Human Tagged ORF Clone

CAT#: RG231677

UBE2H (GFP-tagged) - Homo sapiens ubiquitin-conjugating enzyme E2H (UBE2H), transcript variant 3

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: UBE2H
• Synonyms: E2-20K; GID3; UBC8; UBCH; UBCH2
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG231677 representing NM_001202498
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATAAAATTTTCCATCCCAACATTGATGAAGCGTCAGGAACTGTGTGTCTAGATGTAATTAATCAAA
  CTTGGACAGCTCTCTATGATCTTACCAATATATTTGAGTCCTTCCTGCCTCAGTTATTGGCCTATCCTAA
  CCCCATAGATCCTCTCAATGGTGACGCTGCAGCCATGTACCTCCACCGACCAGAAGAATACAAGCAGAAA
  ATTAAAGAGTACATCCAGAAATACGCCACGGAGGAGGCGCTGAAAGAACAGGAAGAGGGTACCGGGGACA
  GCTCATCGGAGAGCTCTATGTCTGACTTTTCCGAAGATGAGGCCCAGGATATGGAGTTG
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG231677 representing NM_001202498
  Red=Cloning site Green=Tags(s)
  
  MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQK
  IKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001202498
• ORF Size: 339 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001202498.1, NP_001189427.1
• RefSeq Size: 4778 bp
• RefSeq ORF: 342 bp
• Locus ID: 7328
• Cytogenetics: 7q32.2
• Protein Pathways: Ubiquitin mediated proteolysis
• Gene Summary: 'The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Three alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq, Feb 2011]'