PRPS1 (NM_001204402) Human Tagged ORF Clone

CAT#: RG231683

PRPS1 (GFP-tagged) - Homo sapiens phosphoribosyl pyrophosphate synthetase 1 (PRPS1), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: PRPS1
• Synonyms: ARTS; CMTX5; DFN2; DFNX1; PPRibP; PRS-I; PRSI
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG231683 representing NM_001204402
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTGCTTGTGGGAGATGTGAAGGATCGGGTGGCCATCCTTGTGGATGACATGGCTGACACTTGTGGCA
  CAATCTGCCATGCAGCTGACAAACTTCTCTCAGCTGGCGCCACCAGAGTTTATGCCATCTTGACTCATGG
  AATCTTCTCCGGTCCTGCTATTTCTCGCATCAACAACGCATGCTTTGAGGCAGTAGTAGTCACCAATACC
  ATACCTCAGGAGGACAAGATGAAGCATTGCTCCAAAATACAGGTGATTGACATCTCTATGATCCTTGCAG
  AAGCCATCAGGAGAACTCACAATGGAGAATCCGTTTCTTACCTATTCAGCCATGTCCCTTTA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG231683 representing NM_001204402
  Red=Cloning site Green=Tags(s)
  
  MVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNT
  IPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001204402
• ORF Size: 342 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001204402.1, NP_001191331.1
• RefSeq Size: 1748 bp
• RefSeq ORF: 345 bp
• Locus ID: 5631
• Cytogenetics: Xq22.3
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway, Purine metabolism
• Gene Summary: 'This gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosphate synthetase superactivity, Charcot-Marie-Tooth disease X-linked recessive type 5 and Arts Syndrome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]'