Chloride Channel 5 (CLCN5) (NM_001272102) Human Tagged ORF Clone

CAT#: RG235441

CLCN5 (GFP-tagged) - Human chloride channel, voltage-sensitive 5 (CLCN5), transcript variant 5

Specifications

Product Data

• Tag: TurboGFP
• Symbol: CLCN5
• Synonyms: ClC-5; CLC5; CLCK2; DENTS; hCIC-K2; NPHL1; NPHL2; XLRH; XRN
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG235441 representing NM_001272102.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGCCATGTGGCAGGGTGCCATGGATAACAGAGGCTTTCAGCAGGGGAGTTTTAGTAGCTTCCAGAAC
  AGCTCCAGTGATGAAGACCTGATGGACATTCCAGCAACCGCTATGGATTTCTCCATGAGAGATGATGTT
  CCTCCCTTAGACCGAGAAGTAGGAGGTATCATTATTGGTGATGATAATTTATCT
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
  
  Protein Sequence

  >Peptide sequence encoded by RG235441
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVGGIIIGDDNLS
  TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
  MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
  SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
  FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001272102
• ORF Size: 192 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NM_001272102.2
• RefSeq Size: 640 bp
• RefSeq ORF: 195 bp
• Locus ID: 1184
• Cytogenetics: Xp11.23
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• MW: 7.5 kDa
• Gene Summary: 'This gene encodes a member of the ClC family of chloride ion channels and ion transporters. The encoded protein is primarily localized to endosomal membranes and may function to facilitate albumin uptake by the renal proximal tubule. Mutations in this gene have been found in Dent disease and renal tubular disorders complicated by nephrolithiasis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]'