MRPS18C (NM_001297770) Human Tagged ORF Clone

CAT#: RG235447

MRPS18C (GFP-tagged) - Human mitochondrial ribosomal protein S18C (MRPS18C), transcript variant 4

Specifications

Product Data

• Tag: TurboGFP
• Symbol: MRPS18C
• Synonyms: CGI-134; MRP-S18-1; MRP-S18-c; MRPS18-1; mrps18-c; S18mt-c
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG235447 representing NM_001297770.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGCCGCTGTGGTTGCTGTTTGCGGTGGTCTAGGGAGGAAGAAGTTGACACACTTGGTAACGGCTGCT
  GTCAGCCTTACACATCCCGGGACTCACACGGTGCTTTGGAGAAGAGGTTGTTCACAACAGGTATCCAGC
  AATGAGGACCTGGTCTTTGTGGGAAGAAACAGAAAGAAATCACAAAAGCAATTAAGAGAGCTCAAA
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
  
  Protein Sequence

  >Peptide sequence encoded by RG235447
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLVFVGRNRKKSQKQLRELK
  TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
  MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
  SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
  FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV
  
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001297770
• ORF Size: 204 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NM_001297770.1, NP_001284699.1
• RefSeq Size: 959 bp
• RefSeq ORF: 207 bp
• Locus ID: 51023
• Cytogenetics: 4q21.23
• MW: 7.9 kDa
• Gene Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 8p, 12p, 15q, and 22q. [provided by RefSeq, Jul 2008]