Fxyd6 (NM_022005) Rat Tagged ORF Clone

CAT#: RR206277

Fxyd6 (Myc-DDK-tagged ORF) - Rat FXYD domain-containing ion transport regulator 6 (Fxyd6), (10 ug)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Fxyd6
• Synonyms: Php
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR206277 representing NM_022005
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGACGGTGCTGATCCTCTGCAGCTTGCTGGCCCCTGTGGTCCTGGCTAGTGCAGCTGAGAAGGAGA
  AAGAAAAGGATCCTTTCTATTATGACTACCAGACCCTGAGGATTGGGGGATTGGTGTTTGCTGTGGTCCT
  CTTCTCTGTTGGGATACTTCTCATCCTAAGTCGCAGGTGCAAGTGCAGTTTCAATCAGAAACCCAGGGCT
  CCAGGTGATGAAGAGGCCCAGGTGGAGAACCTTATCACCACAAATGCTGCGGAGCCCCAGAAGGCAGAGA
  AC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR206277 representing NM_022005
  Red=Cloning site Green=Tags(s)
  
  METVLILCSLLAPVVLASAAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRA
  PGDEEAQVENLITTNAAEPQKAEN
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_022005
• ORF Size: 282 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_022005.1, NM_022005.2, NP_071288.1
• RefSeq Size: 1784
• RefSeq ORF: 285
• Locus ID: 63847
• MW: 10.4 kDa
• Gene Summary: This reference sequence was derived from multiple replicate ESTs and a deposited cDNA, and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and has not been characterized as a protein. The name "phosphohippolin" has been used in GenBank, but there is no evidence yet of protein phosphorylation. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000]