Selenom (NM_001115013) Rat Tagged ORF Clone

CAT#: RR208874

  • TrueORF®

Selm (Myc-DDK-tagged ORF) - Rat selenoprotein M (Selm), (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)


  "NM_001115013" in other vectors (3)

Reconstitution Protocol

USD 420.00

4 Weeks*

Size
    • 10 ug

Product Images

Other products for "Selenom"

Specifications

Product Data
Type Rat Tagged ORF Clone
Symbol Selenom
Synonyms RGD1565037; Selm
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR208874 representing NM_001115013
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACATCCTACTGTCGCCGCCGCCGCTGCTGCTGCTTCTCGCAGCCCTTGTGGCTCCAGCCACCTCCA
TCACCACCTACCGACCGGATTGGAACCGTCTTCGAGGCCTGGCCAGGGGGCGGGTGGAGACCTGTGGAGG
ATGACAGTTGAATCGCTTAAAGGAGGTGAAGGCCTTTGTCACTCAGGACATTCAACTGTACCACAACCTG
GTGATGAAGCACCTCCCTGGGGCAGACCCCGAACTCGTGTTGTTAAGCCGAAATTACCAGGAACTAGAGC
GAATCCCACTCAGCCAAATGACCCGGGACGAGATAAACGCGCTGGTACAGGAGCTCGGCTTCTACCGTAA
GTCGGCGCCCGAAGCGAAGGTGCCCCCCGAGTACCTGTGGGCGCCCGCTAAGCCCCCCGAGGACGCTTCG
GACCGCGCCGACTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR208874 representing NM_001115013
Red=Cloning site Green=Tags(s)

MNILLSPPPLLLLLAALVAPATSITTYRPDWNRLRGLARGRVETCGG*QLNRLKEVKAFVTQDIQLYHNL
VMKHLPGADPELVLLSRNYQELERIPLSQMTRDEINALVQELGFYRKSAPEAKVPPEYLWAPAKPPEDAS
DRADL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001115013
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Reference Data
RefSeq NM_001115013.1, NM_001115013.2, NP_001108485.1
RefSeq Size 696
RefSeq ORF 438
Locus ID 498398
MW 16.3 kDa
Gene Summary The protein encoded by this gene belongs to the selenoprotein M/SEP15 family. The exact function of this protein is not known. It is localized in the perinuclear region, is highly expressed in the brain, and may be involved in neurodegenerative disorders. Transgenic mice with targeted deletion of this gene exhibit increased weight gain, suggesting a role for this gene in the regulation of body weight and energy metabolism. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. [provided by RefSeq, Dec 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.