Gtf2h5 (NM_001126088) Rat Tagged ORF Clone

CAT#: RR214593

  • TrueORF®

Gtf2h5 (Myc-DDK-tagged ORF) - Rat general transcription factor IIH, polypeptide 5 (Gtf2h5), (10 ug)


  "NM_001126088" in other vectors (3)

Reconstitution Protocol

USD 420.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Gtf2h5"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Gtf2h5
Synonyms RGD1560991
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR214593 representing NM_001126088
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCAACGTCTTGAAAGGAGTGCTTATAGAATGCGATCCCGCCATGAAGCAGTTTTTGCTGTACTTGG
ATGAGTCCAATGCCTTGGGGAAGAAGTTCATCATTCAAGACATTGATGACACACATGTCTTTGTCATTGC
GGAACTGGTTAATGTTCTCCAGGAGCGAGTAGGGGAACTGATGGACCAGAATGCCTTTTCTCTTACCCAG
AAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR214593 representing NM_001126088
Red=Cloning site Green=Tags(s)

MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ
K

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001126088
ORF Size 213 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001126088.1, NP_001119560.1
RefSeq Size 1655
RefSeq ORF 216
Locus ID 502227
MW 8.5 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.