p57 Kip2 (CDKN1C) (NM_000076) Human Mutant ORF Clone
CAT#: RC401065
- TrueORF®
CDKN1C Mutant (Q47X), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1 as transfection-ready DNA
Product Images
Other products for "CDKN1C"
Specifications
Product Data | |
Mutation Description | Q47X |
Affected Codon# | 47 |
Affected NT# | 139 |
Tag | Myc-DDK |
Effect | Beckwith-Wiedemann syndrome |
Symbol | CDKN1C |
Synonyms | BWCR; BWS; KIP2; p57; p57Kip2; WBS |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Vector | pCMV6-Entry |
ACCN | NM_000076 |
ORF Size | 138 bp |
Sequence Data |
>RC401065 representing NM_000076
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGACGCGTCCCTCCGCAGCACATCCACGATGGAGCGTCTTGTCGCCCGTGGGACCTTCCCAGTAC TAGTGCGCACCAGCGCCTGCCGCAGCCTCTTCGGGCCGGTGGACCACGAGGAGCTGAGCCGCGAGCTG AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGA TAAGGTTTAA >RC401065 representing NM_000076
Red=Cloning site Green=Tags(s) MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSREL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-RsrII Cloning Scheme for this gene |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reference Data | |
RefSeq | NP_000067 |
RefSeq Size | 138 bp |
RefSeq ORF | 951 bp |
Locus ID | 1028 |
Cytogenetics | 11p15.4 |
Domains | CDI |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
MW | 5.1 kDa |
Gene Summary | 'This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]' |
Documents
Product Manuals |
FAQs |
Resources
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.