NF2 (NM_000268) Human Mutant ORF Clone

CAT#: RC401943

  • TrueORF®

NF2 Mutant (R198X), Myc-DDK-tagged ORF clone of Homo sapiens neurofibromin 2 (merlin) (NF2), transcript variant 1 as transfection-ready DNA

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Mutation Description R198X
Affected Codon# 198
Affected NT# 592
Tag Myc-DDK
Effect Neurofibromosis 2
Symbol NF2
Synonyms ACN; BANF; SCH
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_000268
ORF Size 591 bp
Sequence Data
>RC401943 representing NM_000268
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGGGGCCATCGCTTCCCGCATGAGCTTCAGCTCTCTCAAGAGGAAGCAACCCAAGACGTTCACCG
TGAGGATCGTCACCATGGACGCCGAGATGGAGTTCAATTGCGAGATGAAGTGGAAAGGGAAGGACCTCTT
TGATTTGGTGTGCCGGACTCTGGGGCTCCGAGAAACCTGGTTCTTTGGACTGCAGTACACAATCAAGGAC
ACAGTGGCCTGGCTCAAAATGGACAAGAAGGTACTGGATCATGATGTTTCAAAGGAAGAACCAGTCACCT
TTCACTTCTTGGCCAAATTTTATCCTGAGAATGCTGAAGAGGAGCTGGTTCAGGAGATCACACAACATTT
ATTCTTCTTACAGGTAAAGAAGCAGATTTTAGATGAAAAGATCTACTGCCCTCCTGAGGCTTCTGTGCTC
CTGGCTTCTTACGCCGTCCAGGCCAAGTATGGTGACTACGACCCCAGTGTTCACAAGCGGGGATTTTTGG
CCCAAGAGGAATTGCTTCCAAAAAGGGTAATAAATCTGTATCAGATGACTCCGGAAATGTGGGAGGAGAG
AATTACTGCTTGGTACGCAGAGCACCGAGGC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401943 representing NM_000268
Red=Cloning site Green=Tags(s)

MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKD
TVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVL
LASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRG

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NP_000259
RefSeq Size 591 bp
RefSeq ORF 1788 bp
Locus ID 4771
Cytogenetics 22q12.2
Domains B41, ERM
Protein Families Druggable Genome
MW 21.7 kDa
Gene Summary 'This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq, Jul 2008]'

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.