RTRAF (NM_016039) Human Mass Spec Standard
CAT#: PH300016
C14orf166 MS Standard C13 and N15-labeled recombinant protein (NP_057123)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200016 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC200016 protein sequence
Red=Cloning site Green=Tags(s) MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCP FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL LQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIE ELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057123 |
RefSeq Size | 1064 |
RefSeq ORF | 732 |
Synonyms | C14orf166; CGI-99; CGI99; CLE; CLE7; hCLE; hCLE1; LCRP369; RLLM1 |
Locus ID | 51637 |
UniProt ID | Q9Y224, Q549M8 |
Cytogenetics | 14q22.1 |
Summary | RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264). [UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414235 | C14orf166 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414235 | Transient overexpression lysate of chromosome 14 open reading frame 166 (C14orf166) |
USD 396.00 |
|
TP300016 | Recombinant protein of human chromosome 14 open reading frame 166 (C14orf166) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review