VPS28 (NM_016208) Human Mass Spec Standard
CAT#: PH300025
VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200025 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC200025 protein sequence
Red=Cloning site Green=Tags(s) MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES AYNAFNRFLHA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057292 |
RefSeq Size | 994 |
RefSeq ORF | 663 |
Synonyms | MGC60323 |
Locus ID | 51160 |
UniProt ID | Q9UK41, Q548N1 |
Cytogenetics | 8q24.3 |
Summary | This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Pathways | Endocytosis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405220 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414122 | VPS28 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405220 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 |
USD 396.00 |
|
LY414122 | Transient overexpression lysate of vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 |
USD 396.00 |
|
PH308726 | VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880) |
USD 2,055.00 |
|
TP300025 | Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1 |
USD 823.00 |
|
TP308726 | Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2 |
USD 823.00 |
|
TP761364 | Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review