TMEM208 (NM_014187) Human Mass Spec Standard
CAT#: PH300049
TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200049 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC200049 protein sequence
Red=Cloning site Green=Tags(s) MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054906 |
RefSeq Size | 808 |
RefSeq ORF | 519 |
Synonyms | HSPC171 |
Locus ID | 29100 |
UniProt ID | Q9BTX3 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415449 | TMEM208 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415449 | Transient overexpression lysate of transmembrane protein 208 (TMEM208) |
USD 396.00 |
|
TP300049 | Recombinant protein of human transmembrane protein 208 (TMEM208) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review