TMEM208 (NM_014187) Human Mass Spec Standard

CAT#: PH300049

TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906)

Product Images

Coomassie blue staining of purified TMEM208 protein (Cat# TP300049). The protein was produced from HEK293T cells transfected with TMEM208 cDNA clone (Cat# RC200049) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200049
• Predicted MW: 19.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200049 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHS
  MSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVN
  VLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054906
• RefSeq Size: 808
• RefSeq ORF: 519
• Synonyms: HSPC171
• Locus ID: 29100
• UniProt ID: Q9BTX3
• Cytogenetics: 16q22.1
• Summary: This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Protein Families: Transmembrane