METTL11A (NTMT1) (NM_014064) Human Mass Spec Standard

CAT#: PH300055

METTL11A MS Standard C13 and N15-labeled recombinant protein (NP_054783)

Product Images

Coomassie blue staining of purified NTMT1 protein (Cat# TP300055). The protein was produced from HEK293T cells transfected with NTMT1 cDNA clone (Cat# RC200055) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200055
• Predicted MW: 25.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200055 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTGTSCALDCGA
  GIGRITKRLLLPLFREVDMVDITEDFLVQAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGH
  LTDQHLAEFLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAGLSLLAEERQENL
  PDEIYHVYSFALR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054783
• RefSeq Size: 1536
• RefSeq ORF: 669
• Synonyms: AD-003; C9orf32; HOMT1A; METTL11A; NRMT; NRMT1; NTM1A
• Locus ID: 28989
• UniProt ID: Q9BV86, A0A024R8E4
• Cytogenetics: 9q34.11
• Summary: The METTL11A gene encodes an N-terminal methyltransferase for the RAN (MIM 601179) guanine nucleotide exchange factor regulator of chromosome condensation 1 (RCC1; MIM 179710). METTL11A enzyme alpha-N-methylates other protein targets such as SET (MIM 600960) and RB (MIM 180200). [supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome