GMPPB (NM_021971) Human Mass Spec Standard
CAT#: PH300186
GMPPB MS Standard C13 and N15-labeled recombinant protein (NP_068806)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200186 |
Predicted MW | 39.9 kDa |
Protein Sequence |
>RC200186 protein sequence
Red=Cloning site Green=Tags(s) MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQR LGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSDVICDFPFQAMVQFHRHHGQEGSILVTKVEE PSKYGVVVCEADTGRIHRFVEKPQVFVSNKINAGMYILSPAVLRRIQLQPTSIEKEVFPIMAKEGQLYAM ELQGFWMDIGQPKDFLTGMCLFLQSLRQKQPERLCSGPGIVGNVLVDPSARIGQNCSIGPNVSLGPGVVV EDGVCIRRCTVLRDARIRSHSWLESCIVGWRCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIG ESVPEPRIIM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_068806 |
RefSeq Size | 1607 |
RefSeq ORF | 1080 |
Synonyms | LGMDR19; MDDGA14; MDDGB14; MDDGC14 |
Locus ID | 29925 |
UniProt ID | Q9Y5P6 |
Cytogenetics | 3p21.31 |
Summary | This gene is thought to encode a GDP-mannose pyrophosphorylase. The encoded protein catalyzes the conversion of mannose-1-phosphate and GTP to GDP-mannose, a reaction involved in the production of N-linked oligosaccharides. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2009] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411846 | GMPPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC415640 | GMPPB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411846 | Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2 |
USD 396.00 |
|
LY415640 | Transient overexpression lysate of GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 1 |
USD 396.00 |
|
TP300186 | Recombinant protein of human GDP-mannose pyrophosphorylase B (GMPPB), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review