SIRT5 (NM_012241) Human Mass Spec Standard

CAT#: PH300189

SIRT5 MS Standard C13 and N15-labeled recombinant protein (NP_036373)

Product Images

Coomassie blue staining of purified SIRT5 protein (Cat# TP300189). The protein was produced from HEK293T cells transfected with SIRT5 cDNA clone (Cat# RC200189) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200189
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200189 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTF
  RGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQ
  NIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEA
  GCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTP
  ATNRFRFHFQGPCGTTLPEALACHENETVS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036373
• RefSeq Size: 4538
• RefSeq ORF: 930
• Synonyms: SIR2L5
• Locus ID: 23408
• UniProt ID: Q9NXA8, A0A024R012
• Cytogenetics: 6p23
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome, Transcription Factors