DNAJB11 (NM_016306) Human Mass Spec Standard
CAT#: PH300216
DNAJB11 MS Standard C13 and N15-labeled recombinant protein (NP_057390)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200216 |
Predicted MW | 40.5 kDa |
Protein Sequence |
>RC200216 protein sequence
Red=Cloning site Green=Tags(s) MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK VYNGLQGY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057390 |
RefSeq Size | 1698 |
RefSeq ORF | 1074 |
Synonyms | ABBP-2; ABBP2; Dj-9; DJ9; EDJ; ERdj3; ERj3; ERj3p; PKD6; PRO1080; UNQ537 |
Locus ID | 51726 |
UniProt ID | Q9UBS4 |
Cytogenetics | 3q27.3 |
Summary | This gene encodes a soluble glycoprotein of the endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required for the proper folding and assembly of proteins in the ER. The encoded protein contains a highly conserved J domain of about 70 amino acids with a characteristic His-Pro-Asp (HPD) motif and may regulate the activity of binding immunoglobulin protein by stimulating ATPase activity. [provided by RefSeq, Mar 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402537 | DNAJB11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402537 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) |
USD 396.00 |
|
TP300216 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review