TRK fused gene (TFG) (NM_001007565) Human Mass Spec Standard
CAT#: PH300293
TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200293 |
Predicted MW | 43.4 kDa |
Protein Sequence |
>RC200293 protein sequence
Red=Cloning site Green=Tags(s) MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001007566 |
RefSeq Size | 1841 |
RefSeq ORF | 1200 |
Synonyms | HMSNP; SPG57; TF6; TRKT3 |
Locus ID | 10342 |
UniProt ID | Q92734 |
Cytogenetics | 3q12.2 |
Summary | There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401827 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423514 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401827 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 1 |
USD 396.00 |
|
LY423514 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 2 |
USD 396.00 |
|
TP300293 | Recombinant protein of human TRK-fused gene (TFG), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review