AKR1A1 (NM_006066) Human Mass Spec Standard

CAT#: PH300302

AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057)

Product Images

Coomassie blue staining of purified AKR1A1 protein (Cat# TP300302). The protein was produced from HEK293T cells transfected with AKR1A1 cDNA clone (Cat# RC200302) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200302
• Predicted MW: 36.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200302 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV
  PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY
  KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY
  SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT
  FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006057
• RefSeq Size: 1597
• RefSeq ORF: 975
• Synonyms: ALDR1; ALR; ARM; DD3; HEL-S-6
• Locus ID: 10327
• UniProt ID: P14550, V9HWI0
• Cytogenetics: 1p34.1
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011]
• Protein Families: Druggable Genome
• Protein Pathways: Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways