FAM50A (NM_004699) Human Mass Spec Standard

CAT#: PH300370

FAM50A MS Standard C13 and N15-labeled recombinant protein (NP_004690)

Product Images

Coomassie blue staining of purified FAM50A protein (Cat# TP300370). The protein was produced from HEK293T cells transfected with FAM50A cDNA clone (Cat# RC200370) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200370
• Predicted MW: 40.1 kDa
• Protein Sequence:
  Sequence Link

  >RC200370 representing NM_004699
  Red=Cloning site Green=Tags(s)
  
  MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTL
  NDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMY
  EEEMEREEITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEIEITFSYWDGSG
  HRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHHHSFYDFIVTKARGKSGPLF
  NFDVHDDVRLLSDATVEKDESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004690
• RefSeq Size: 1311
• RefSeq ORF: 1017
• Synonyms: 9F; DXS9928E; HXC-26; HXC26; XAP5
• Locus ID: 9130
• UniProt ID: Q14320
• Cytogenetics: Xq28
• Summary: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq, Sep 2009]