ICAM2 (NM_000873) Human Mass Spec Standard
CAT#: PH300459
ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200459 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC200459 protein sequence
Red=Cloning site Green=Tags(s) MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000864 |
RefSeq Size | 1229 |
RefSeq ORF | 825 |
Synonyms | CD102 |
Locus ID | 3384 |
UniProt ID | P13598, Q6FHE2 |
Cytogenetics | 17q23.3 |
Summary | 'The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420535 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420536 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420537 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420538 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424476 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426088 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426089 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426090 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426091 | ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY420535 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 |
USD 396.00 |
|
LY420536 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 |
USD 396.00 |
|
LY420537 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 |
USD 396.00 |
|
LY420538 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 |
USD 396.00 |
|
LY424476 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
USD 396.00 |
|
LY426088 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 |
USD 396.00 |
|
LY426089 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 |
USD 396.00 |
|
LY426090 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 |
USD 396.00 |
|
LY426091 | Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 |
USD 396.00 |
|
PH312720 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) |
USD 2,055.00 |
|
PH312775 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259) |
USD 2,055.00 |
|
PH316706 | ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) |
USD 2,055.00 |
|
TP300459 | Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
USD 439.00 |
|
TP312720 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2 |
USD 823.00 |
|
TP312775 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4 |
USD 748.00 |
|
TP316706 | Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3 |
USD 748.00 |
|
TP720626 | Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review