Apolipoprotein D (APOD) (NM_001647) Human Mass Spec Standard
CAT#: PH300503
APOD MS Standard C13 and N15-labeled recombinant protein (NP_001638)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200503 |
Predicted MW | 21.3 kDa |
Protein Sequence |
>RC200503 protein sequence
Red=Cloning site Green=Tags(s) MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLME NGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQL FHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001638 |
RefSeq Size | 1148 |
RefSeq ORF | 567 |
Synonyms | apolipoprotein D |
Locus ID | 347 |
UniProt ID | P05090 |
Cytogenetics | 3q29 |
Summary | 'This gene encodes a component of high density lipoprotein that has no marked similarity to other apolipoprotein sequences. It has a high degree of homology to plasma retinol-binding protein and other members of the alpha 2 microglobulin protein superfamily of carrier proteins, also known as lipocalins. This glycoprotein is closely associated with the enzyme lecithin:cholesterol acyltransferase - an enzyme involved in lipoprotein metabolism. [provided by RefSeq, Aug 2008]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419822 | APOD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419822 | Transient overexpression lysate of apolipoprotein D (APOD) |
USD 396.00 |
|
TP300503 | Recombinant protein of human apolipoprotein D (APOD) |
USD 823.00 |
|
TP720686 | Purified recombinant protein of Human apolipoprotein D (APOD) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review