p8 (NUPR1) (NM_012385) Human Mass Spec Standard
CAT#: PH300585
NUPR1 MS Standard C13 and N15-labeled recombinant protein (NP_036517)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200585 |
Predicted MW | 8.9 kDa |
Protein Sequence |
>RC200585 protein sequence
Red=Cloning site Green=Tags(s) MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPGGHERKLVTKL QNSERKKRGARR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036517 |
RefSeq Size | 884 |
RefSeq ORF | 246 |
Synonyms | COM1; P8 |
Locus ID | 26471 |
UniProt ID | O60356, A0A024QZC4 |
Cytogenetics | 16p11.2 |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415825 | NUPR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415825 | Transient overexpression lysate of nuclear protein, transcriptional regulator, 1 (NUPR1), transcript variant 2 |
USD 396.00 |
|
TP300585 | Recombinant protein of human nuclear protein 1 (NUPR1), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review