MSH5 (NM_002441) Human Mass Spec Standard
CAT#: PH300607
MSH5 MS Standard C13 and N15-labeled recombinant protein (NP_002432)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200607 |
Predicted MW | 93 kDa |
Protein Sequence |
>RC200607 protein sequence
Red=Cloning site Green=Tags(s) MASLGANPRRTPQGPRPGAASSGFPSPAPVPGPREAEEEEVEEEEELAEIHLCVLWNSGYLGIAYYDTSD STIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDENMTRFLGKLASQEHREPKRPEIIFLPSVDFGL EISKQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILG FKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHD LGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDAC RSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEV ARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALL GDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQN GRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDA IFTRIHSCESISLGLSTFMIDLNQQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPT CPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVA RGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002432 |
RefSeq Size | 2945 |
RefSeq ORF | 2505 |
Synonyms | G7; MUTSH5; NG23; POF13 |
Locus ID | 4439 |
UniProt ID | O43196, A0A024RCM1 |
Cytogenetics | 6p21.33 |
Summary | 'This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair and meiotic recombination. This protein is similar to a Saccharomyces cerevisiae protein that participates in segregation fidelity and crossing-over events during meiosis. This protein plays a role in promoting ionizing radiation-induced apoptosis. This protein forms hetero-oligomers with another member of this family, mutS homolog 4. Polymorphisms in this gene have been linked to various human diseases, including IgA deficiency, common variable immunodeficiency, and premature ovarian failure. Alternative splicing results multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 6 open reading frame 26 (C6orf26) gene. [provided by RefSeq, Feb 2011]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406777 | MSH5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC419330 | MSH5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430348 | MSH5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY406777 | Transient overexpression lysate of mutS homolog 5 (E. coli) (MSH5), transcript variant 4 |
USD 605.00 |
|
LY419330 | Transient overexpression lysate of mutS homolog 5 (E. coli) (MSH5), transcript variant 3 |
USD 396.00 |
|
LY430348 | Transient overexpression lysate of mutS homolog 5 (E. coli) (MSH5), transcript variant 4 |
USD 605.00 |
|
PH312608 | MSH5 MS Standard C13 and N15-labeled recombinant protein (NP_751898) |
USD 2,055.00 |
|
TP300607 | Recombinant protein of human mutS homolog 5 (E. coli) (MSH5), transcript variant 3 |
USD 867.00 |
|
TP312608 | Recombinant protein of human mutS homolog 5 (E. coli) (MSH5), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review