Myosin (MYL6) (NM_021019) Human Mass Spec Standard

CAT#: PH300708

MYL6 MS Standard C13 and N15-labeled recombinant protein (NP_066299)

Product Images

Coomassie blue staining of purified MYL6 protein (Cat# TP300708). The protein was produced from HEK293T cells transfected with MYL6 cDNA clone (Cat# RC200708) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200708
• Predicted MW: 16.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200708 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHF
  LPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN
  YEAFVRHILSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066299
• RefSeq Size: 827
• RefSeq ORF: 453
• Synonyms: ESMLC; LC17; LC17-GI; LC17-NM; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM
• Locus ID: 4637
• UniProt ID: P60660
• Cytogenetics: 12q13.2
• Summary: 'Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Vascular smooth muscle contraction