IKB alpha (NFKBIA) (NM_020529) Human Mass Spec Standard
CAT#: PH300711
NFKBIA MS Standard C13 and N15-labeled recombinant protein (NP_065390)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200711 |
Predicted MW | 35.4 kDa |
Protein Sequence |
>RC200711 representing NM_020529
Red=Cloning site Green=Tags(s) MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQL TEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELR DFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVN AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQML PESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_065390 |
RefSeq Size | 1550 |
RefSeq ORF | 951 |
Synonyms | EDAID2; IKBA; MAD-3; NFKBI |
Locus ID | 4792 |
UniProt ID | P25963 |
Cytogenetics | 14q13.2 |
Summary | 'This gene encodes a member of the NF-kappa-B inhibitor family, which contain multiple ankrin repeat domains. The encoded protein interacts with REL dimers to inhibit NF-kappa-B/REL complexes which are involved in inflammatory responses. The encoded protein moves between the cytoplasm and the nucleus via a nuclear localization signal and CRM1-mediated nuclear export. Mutations in this gene have been found in ectodermal dysplasia anhidrotic with T-cell immunodeficiency autosomal dominant disease. [provided by RefSeq, Aug 2011]' |
Protein Families | Druggable Genome |
Protein Pathways | Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412432 | NFKBIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412432 | Transient overexpression lysate of nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA) |
USD 396.00 |
|
TP300711 | Recombinant protein of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha (NFKBIA) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review